User manual

IntroductionPassport 4400 Hardware Installation Manual

1-8

In addition to the above information you will be required to supply the following

supplementalinformation if your system is an XD,DD,DEor OT requiringthree

or more C.O. lines:

• Sequence in which the trunks are to be connected

• Facility interface codes by position

• Service order codes by position.

Note: The FCC registration label includes the ringer equivalence,

because at the time FCC Part 68 was established, digital

systems without ringing had not been established. Even though

the ringer equivalence must appear on the label, it is

inconsequential in the case of digital communications.

Connection of this unit to the nationwide telecommunications network must be

through a standard network interface jack (RJ48C or RJ11) which must be

ordered from the telephone company.

Telephone Company Rights and Responsibilities

If your data terminal equipment causes harm to the telephone network the

telephone company may discontinue your service temporarily. If possible, they

willnotifyyouinadvance.Butifadvancenoticeisnotpractical,youwillbenotiﬁed

assoon as possible.You will be given theopportunity tocorrect thesituation, and

you will be informed of your right to ﬁle a complaint with the regulatory agency.

Yourtelephonecompanymaymakechangesinitsfacilities,equipment,operation,

or procedures that could affect the proper functioning of your data communi-

cations equipment. If they do, you will be notiﬁed in advance to give you an

opportunity to maintain uninterrupted service.

FCC Requirements

Youmustnotify the telephone company wheneverthePassport4400isconnected

to or disconnected from a telephone company line. This equipment complies with

the Federal Communications Commission (FCC) Rules. On the back of this

equipmentisalabelthatcontains,amongotherinformation,theFCCregistration

number.

Equipment Attachment Limitations for Operation in Canada

CP-01, Part I, Section 10.1

NOTICE:TheCanadianDepartmentofCommunicationslabelidentiﬁescertiﬁed

equipment. This certiﬁcation means that the equipment meets certain telecom-

munications network protective, operational and safety requirements. The

Department does not guarantee the equipment will operate to the user’s

satisfaction.

Before installing this equipment, users should ensure that it is permissible to be

connected to the facilities of the local telecommunications company. The

equipment must also be installed using an acceptable method of connection. In