User manual
IntroductionPassport 4400 Hardware Installation Manual
1-8
In addition to the above information you will be required to supply the following
supplementalinformation if your system is an XD,DD,DEor OT requiringthree
or more C.O. lines:
• Sequence in which the trunks are to be connected
• Facility interface codes by position
• Service order codes by position.
Note: The FCC registration label includes the ringer equivalence,
because at the time FCC Part 68 was established, digital
systems without ringing had not been established. Even though
the ringer equivalence must appear on the label, it is
inconsequential in the case of digital communications.
Connection of this unit to the nationwide telecommunications network must be
through a standard network interface jack (RJ48C or RJ11) which must be
ordered from the telephone company.
Telephone Company Rights and Responsibilities
If your data terminal equipment causes harm to the telephone network the
telephone company may discontinue your service temporarily. If possible, they
willnotifyyouinadvance.Butifadvancenoticeisnotpractical,youwillbenotified
assoon as possible.You will be given theopportunity tocorrect thesituation, and
you will be informed of your right to file a complaint with the regulatory agency.
Yourtelephonecompanymaymakechangesinitsfacilities,equipment,operation,
or procedures that could affect the proper functioning of your data communi-
cations equipment. If they do, you will be notified in advance to give you an
opportunity to maintain uninterrupted service.
FCC Requirements
Youmustnotify the telephone company wheneverthePassport4400isconnected
to or disconnected from a telephone company line. This equipment complies with
the Federal Communications Commission (FCC) Rules. On the back of this
equipmentisalabelthatcontains,amongotherinformation,theFCCregistration
number.
Equipment Attachment Limitations for Operation in Canada
CP-01, Part I, Section 10.1
NOTICE:TheCanadianDepartmentofCommunicationslabelidentifiescertified
equipment. This certification means that the equipment meets certain telecom-
munications network protective, operational and safety requirements. The
Department does not guarantee the equipment will operate to the user’s
satisfaction.
Before installing this equipment, users should ensure that it is permissible to be
connected to the facilities of the local telecommunications company. The
equipment must also be installed using an acceptable method of connection. In










